Robetta8p6q
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 699989 | Complete | Structure prediction | Valentine | Robetta8p6q | 45 | 25 Jan 2026 | 12 Mar 2026 |
1 . 10 . 20 . 30 . 40 .
sequence: SCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFN
disopred: DD---DD--------------------------------------
tmhmm: ---------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 690363 | 1 | 1 | 0.90 | comparative modeling | 1-45 | 45 | 26 Jan 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington