molde_finalpymol_rpoB_M_tuberculosis.pdb Domain 1 Parse 1 Confidence: n/a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
703448CompleteStructure prediction Ajreyescmolde_finalpymol_rpoB_M_t...805 May 202620 Jun 2026
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
69329911n/acomparative modeling1-80806 May 2026
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
   sequence: TLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIG
| Download | View
Powered by 3Dmol.js


Alignment cluster 1 [ RosettaCM constraints ]

Powered by MSAViewer



Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington