molde_finalpymol_rpoB_M_tuberculosis.pdb
| Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
|---|
| 703448 | Complete | Structure prediction | Ajreyesc | molde_finalpymol_rpoB_M_t... | 80 | 5 May 2026 | 20 Jun 2026 |
1 . 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80
sequence: TLINIRPVVAAIKEFFGTSQLSQFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIG
disopred: ----------------------------------------------------------------------------DDDD
tmhmm: --------------------------------------------------------------------------------
| Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
|---|
| 693299 | 1 | 1 | n/a | comparative modeling | 1-80 | 80 | 6 May 2026 |
Baker Lab | Rosetta@home | Contact | Terms of Service
©2026 University of Washington