T1004_transition

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
514CompleteDomain predictioncaspT1004_transition19117 Jul 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190 
   sequence: GLPSNKNAVISGTNILDIASPGVYFVMGMTGGMPSGVSSGFLDLSVDANDNRLARLTDAETGKEYTSIKKPTGTYTAWKKEFEPKDMEKYLLSSIRDDGSASFPLLVYTSDSKTFQQAIIDHIDRTGQTTFTFYVQGGVSGSPMSNSCRGLFMSDTPNTSSLHGVYNAIGTDGRNVTGSVVGSNWTSPKTS
 deepconcnf: --------EE-----------EEEEEE----------EEEEEEEEEE----EEEEEEE-----EEEEEE------HHHHHH---------EEEEE-----EEEEEEEEE---HHHHHHHHHHHHHH---EEEEEEE-----------EEEEEEE---------EEEEEE-----EEEEEEE----------
    psipred: -------EEEE---HHH-----EEEEE-------------EEEEEE-----EEEEEE------EEEEE---------HHH---HHHHHHH--------------EEEEEE----HHHHHHHHHHH----EEEEEEE-----------EEEEEEE--------EEEEEEE-----EEEEEEE----------
    spider3: --------EEE-----------EEEEE------------EEEEEEE-----EEEEEEE-----EEEEE---------------HHHEEEEE----------EE-EEEEE-----HHHHHHHHHHHH---EEEEEEE-------------EEEEE---------EEEEEEE-----EEEEEE----------
   disopred: DDDDDDDDDDD--------------------------------------------------------D--DDD-D------------------------------------------------------------------D-DD--------------------------------------DDDDDDDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
738110.46comparative modeling1-19119117 Jul 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2023 University of Washington